PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe6G294300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 261aa    MW: 30185.6 Da    PI: 9.7712
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe6G294300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.48.9e-153988148
                       TSSS-HHHHH...HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEde...llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rgrW++ Ed     lv++vk +G+++W++Ia++++ gR +kqc++rwq++l
  Aqcoe6G294300.1.p 39 RGRWSAAEDSpyrYLVRLVKIYGTKSWSRIAAMLN-GRIGKQCRERWQNHL 88
                       89999999953337*********************.*************97 PP

2Myb_DNA-binding56.94.7e-1894139148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        ++ W  eEd+ ++da+k++G++ W++Ia+ ++ gRt++ +k+rw++y+
  Aqcoe6G294300.1.p  94 KQDWCVEEDKAFIDAHKEFGNH-WAKIAKLIP-GRTENAIKNRWNTYR 139
                        67899*****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0253488IPR017930Myb domain
SuperFamilySSF466896.72E-53680IPR009057Homeodomain-like
SMARTSM007172.0E-103890IPR001005SANT/Myb domain
PfamPF002492.3E-133988IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-194093IPR009057Homeodomain-like
CDDcd001672.49E-114188No hitNo description
SuperFamilySSF466891.67E-2768147IPR009057Homeodomain-like
PROSITE profilePS5129423.6389143IPR017930Myb domain
SMARTSM007173.8E-1593141IPR001005SANT/Myb domain
PfamPF002492.1E-1694139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-2194141IPR009057Homeodomain-like
CDDcd001671.82E-1197138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MSNICIEEDM SLLPENNSFV VKNRFLPNVV SREKHFVTRG RWSAAEDSPY RYLVRLVKIY  60
GTKSWSRIAA MLNGRIGKQC RERWQNHLCP DIKKQDWCVE EDKAFIDAHK EFGNHWAKIA  120
KLIPGRTENA IKNRWNTYRR KYLLKGNKQK TGVNNQTNSE LLEYISLRTR MGMLEGNVKK  180
KPKTVSFNCN LAVKGKEIEE SQEVYKPFIP FAVNENTHGE QLNVVREPNH VLVEDMELSA  240
LLSGLEIPKS GFSQGVWSWE *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-35361411104C-Myb DNA-Binding Domain
1mse_C2e-35361411104C-Myb DNA-Binding Domain
1a5j_A2e-35371415107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009334146.14e-41PREDICTED: transcription factor MYB98-like
TrEMBLA0A0D2NEN81e-39A0A0D2NEN8_G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.11e-39myb domain protein 118